The domain within your query sequence starts at position 2 and ends at position 81; the E-value for the COX7B domain shown below is 7.5e-40.
MFPLARYALNYLKTPSILKIVGRLKHSKPSSEETHDKYGNMMLISGTIFCLAGYTIYMTQ MGVEWNLSPIGRVTPQEWKK
COX7B |
 |
|---|
| PFAM accession number: | PF05392 |
|---|---|
| Interpro abstract (IPR008433): | Cytochrome oxidase subunit VIIB is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The X-ray structure of azide-bound fully oxidized cytochrome c oxidase from bovine heart at 2.9 A resolution has been determined [ (PUBMED:10771420) ]. |
| GO component: | mitochondrial respirasome (GO:0005746) |
| GO function: | cytochrome-c oxidase activity (GO:0004129) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX7B