The domain within your query sequence starts at position 23 and ends at position 79; the E-value for the COX7a domain shown below is 1.3e-34.
ENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLTLGGTAYCLYCLGWASFPHK
COX7a |
---|
PFAM accession number: | PF02238 |
---|---|
Interpro abstract (IPR039297): | Cytochrome c oxidase, a 13 sub-unit complex, is the terminal oxidase in the mitochondrial electron transport chain. This family contains both heart and liver isoforms of cytochrome c oxidase subunit VIIa [ (PUBMED:9615220) (PUBMED:15596720) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX7a