The domain within your query sequence starts at position 56 and ends at position 110; the E-value for the COX7a domain shown below is 4.8e-30.

KNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRN

COX7a

COX7a
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX7a