The domain within your query sequence starts at position 25 and ends at position 67; the E-value for the COX8 domain shown below is 9.6e-25.

VSAKPAKTPTSAVEQAVGISAIVVGFMVPAGWVLAHLESYKKS

COX8

COX8
PFAM accession number:PF02285
Interpro abstract (IPR003205):

Cytochrome c oxidase (EC 1.9.3.1) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen [(PUBMED:6307356)]. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.

In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits.This entry is composed of cytochrome c oxidase subunit VIII.

GO function:cytochrome-c oxidase activity (GO:0004129)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX8