The domain within your query sequence starts at position 16 and ends at position 320; the E-value for the COesterase domain shown below is 1.4e-111.
VWMACLLLIFPTTVIGPKVTQPEVDTPLGRVRGRQVGVKDTDRMVNVFLGIPFAQAPLGP
LRFSAPLPPQPWEGVRDASINPPMCLQDVERMSNSRFTLNEKMKIFPISEDCLTLNIYSP
TEITAGDKRPVMVWIHGGSLLVGSSTSHDGSALAAYGDVVVVTVQYRLGIFGFLSTGDKH
MPGNRGFLDVVAALRWVQGNIAPFGGDPNCVTIFGNSAGGIIVSSLLLSPMSAGLFHRAI
SQSGVVISKILEDLNAWSEAQNFANSVACGSASPAELVQCLLQKEGKDLITKFWNILDKM
EHLSQ
COesterase |
 |
---|
PFAM accession number: | PF00135 |
---|
Interpro abstract (IPR002018): |
Higher eukaryotes have many distinct esterases. Among the different types are those which act on carboxylic esters (EC 3.1.1). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [(PUBMED:3163407), (PUBMED:1862088), (PUBMED:8453375)] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COesterase