The domain within your query sequence starts at position 209 and ends at position 434; the E-value for the CP2 domain shown below is 2.1e-79.

RSTPDSTYSESFKDGASEKFRSTSVGADEYTYDQTGSGTFQYTLEATKSLRQKQGEGPMT
YLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAK
QRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLP
LMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKVIVRHRVTSGQELKA

CP2

CP2
PFAM accession number:PF04516
Interpro abstract (IPR007604): This entry represents a conserved region in the CP2 transcription factor family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CP2