The domain within your query sequence starts at position 214 and ends at position 438; the E-value for the CP2 domain shown below is 8.5e-88.

STYSESFKDGASEKFRSTSVGADEYTYDQTGSGTFQYTLEATKSLRQKQGEGPMTYLNKG
QFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLD
IADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQI
DTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGK

CP2

CP2
PFAM accession number:PF04516
Interpro abstract (IPR007604): This entry represents a conserved region in the CP2 transcription factor family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CP2