The domain within your query sequence starts at position 608 and ends at position 779; the E-value for the CPSF100_C domain shown below is 5.7e-46.
VRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEEGELKDDGEDSEMQVDAP SDSSAMAQQKAMKSLFGEDEKELGEETEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQV LLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQY
CPSF100_C |
---|
PFAM accession number: | PF13299 |
---|---|
Interpro abstract (IPR025069): | This domain lies at the C terminus of many fungal and plant cleavage and polyadenylation specificity factor subunit 2 proteins. The exact function of the domain is not known, but is likely to function as a binding domain for the protein within the overall CPSF complex [ (PUBMED:19748916) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CPSF100_C