The domain within your query sequence starts at position 1071 and ends at position 1407; the E-value for the CPSF_A domain shown below is 4.9e-94.

AFSIQLISPVSWEAIPNARIELEEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEE
VTCRGRILIMDVIEVVPEPGQPLTKNKFKVLYEKEQKGPVTALCHCNGHLVSAIGQKIFL
WSLRASELTGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAKP
LEVYSVDFMVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRADFHVGAHVNTFW
RTPCRGAAEGPSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPH
HAGLNPRAFRMLHVDRRILQNAVRNVLDGELLNRYLY

CPSF_A

CPSF_A
PFAM accession number:PF03178
Interpro abstract (IPR004871): This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit. CPSF is involved in mRNA polyadenylation and binds the AAUAAA conserved sequence in pre-mRNA. CPSF has also been found to be necessary for splicing of single-intron pre-mRNAs [(PUBMED:11421366)]. The function of the aligned region is unknown but may be involved in RNA/DNA binding.
GO component:nucleus (GO:0005634)
GO function:nucleic acid binding (GO:0003676)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CPSF_A