The domain within your query sequence starts at position 1 and ends at position 211; the E-value for the CR6_interact domain shown below is 1.5e-79.

MAALAMRSGYLLRLSVALGPRSRSYRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQ
FGRHGAISGVPPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQR
IAECMAKMPQMIENWRKQKRERWEKIQADKERRARLQAEAQERLGYHVDPRSARFQELLQ
DLDKQQRKRLKEERQRQKKEARIAAMASAEA

CR6_interact

• PFAM accession number: PF10147
• Interpro abstract (IPR018472):

  Members of this family of proteins act as negative regulators of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occur also in the absence of GADD45 proteins. Furthermore, they act as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity [ (PUBMED:12716909) ]. They may be involved in the hormone-mediated regulation of NR4A1 transcriptional activity.

• GO component: nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CR6_interact