The domain within your query sequence starts at position 98 and ends at position 219; the E-value for the CRAL_TRIO domain shown below is 8e-13.
QALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNG FVLIIDWSNFTFKQASKLTPNMLRLAIEGLQVRVHHCYCFFVSCMVLALFVMYWVSYEIV KT
CRAL_TRIO |
![]() |
---|
PFAM accession number: | PF00650 |
---|---|
Interpro abstract (IPR001251): | The CRAL-TRIO domain is a protein structural domain that binds small lipophilic molecules [ (PUBMED:12767229) ]. The domain is named after cellular retinaldehyde-binding protein (CRALBP) and TRIO guanine exchange factor. The CRAL-TRIO domain is found in GTPase-activating proteins (GAPs), guanine nucleotide exchange factors (GEFs) and a family of hydrophobic ligand binding proteins, including the yeast SEC14 protein and mammalian retinaldehyde- and alpha-tocopherol-binding proteins. The domain may either constitute all of the protein or only part of it [ (PUBMED:2198263) (PUBMED:8349655) (PUBMED:9461221) (PUBMED:10829015) ]. The structure of the domain in SEC14 proteins has been determined [ (PUBMED:9461221) ]. The structure contains several alpha helices as well as a beta sheet composed of 6 strands. Strands 2,3,4 and 5 form a parallel beta sheet with strands 1 and 6 being anti-parallel. The structure also identified a hydrophobic binding pocket for lipid binding. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRAL_TRIO