The domain within your query sequence starts at position 1 and ends at position 307; the E-value for the CRF-BP domain shown below is 1.1e-179.

MSPNFKLQCHFILILLTALRGESRYLETIHFPLQVQEAAVYDPLLLFSANLKRDLAEEQP
YRRALRCLDMLSLPGQFTFTADRPQLHCAAFFIGEPEEFITIHYDLVSIDCQGGDFLKVF
DGWILKGEKFPSSQDHPLPTMKRYTDFCESGLTRRSIRSSQNVAMVFFRVHEPGNGFTIT
IKTDPNLFPCNVISQTPSGRFTLVVPYQHQNCSFSIIYPVAIKISDLTLGHLHGLQLKKP
AAGCGGTGDFVELLGGTGLDPSKMMPLADLCYPFLGPAQMKISCDNAVVRMVSSGKHINR
VTFEYRQ

CRF-BP

• PFAM accession number: PF05428
• Interpro abstract (IPR008435):

  This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP). Corticotropin-releasing hormone (CRH) plays multiple roles in vertebrate species. In mammals, it is the major hypothalamic releasing factor for pituitary adrenocorticotropin secretion, and is a neurotransmitter or neuromodulator at other sites in the central nervous system. In non-mammalian vertebrates, CRH not only acts as a neurotransmitter and hypophysiotropin, it also acts as a potent thyrotropin-releasing factor, allowing CRH to regulate both the adrenal and thyroid axes, especially in development. CRH-BP is thought to play an inhibitory role in which it binds CRH and other CRH-like ligands and prevents the activation of CRH receptors. There is however evidence that CRH-BP may also exhibit diverse extra and intracellular roles in a cell specific fashion and at specific times in development [ (PUBMED:12379493) ].

• GO function: corticotropin-releasing hormone binding (GO:0051424)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRF-BP