SMART: Pfam domain CRIC_ras

The domain within your query sequence starts at position 84 and ends at position 178; the E-value for the CRIC_ras_sig domain shown below is 1.3e-47.

NLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLAWLD
RSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVY

CRIC_ras_sig

PFAM accession number:	PF10534
Interpro abstract (IPR017874):	The multi-domain protein Connector enhancer of kinase suppressor of ras (Connector enhancer of KSR) (CNK) functions as a scaffold in several signal cascades and acts on proliferation, differentiation and apoptosis. CNK connects upstream activators and downstream targets of Ras- and Rho-dependent signalling pathways and may allow cross-talk between these pathways. In invertebrates, CNK is expressed as one isoform, whereas in mammals there exists CNK1, CNK2A, and its splice variant CNK2B. CNK proteins consist of one sterile alpha motif (SAM) domain (see IPR001660 ) one conserved region in CNK (CRIC) domain, one PSD-96/Dlg-A/ZO-1 (PDZ) domain (see IPR001478 ) and one pleckstrin homology (PH) domain (see IPR001849 . The CRIC domain is enriched in leucine residues and functions as a protein-protein interaction domain [ (PUBMED:12028359) (PUBMED:16289034) ].

PFAM accession number:

PF10534

Interpro abstract (IPR017874):

The multi-domain protein Connector enhancer of kinase suppressor of ras (Connector enhancer of KSR) (CNK) functions as a scaffold in several signal cascades and acts on proliferation, differentiation and apoptosis. CNK connects upstream activators and downstream targets of Ras- and Rho-dependent signalling pathways and may allow cross-talk between these pathways. In invertebrates, CNK is expressed as one isoform, whereas in mammals there exists CNK1, CNK2A, and its splice variant CNK2B. CNK proteins consist of one sterile alpha motif (SAM) domain (see IPR001660 ) one conserved region in CNK (CRIC) domain, one PSD-96/Dlg-A/ZO-1 (PDZ) domain (see IPR001478 ) and one pleckstrin homology (PH) domain (see IPR001849 . The CRIC domain is enriched in leucine residues and functions as a protein-protein interaction domain [ (PUBMED:12028359) (PUBMED:16289034) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRIC_ras_sig