The domain within your query sequence starts at position 139 and ends at position 276; the E-value for the CRIM domain shown below is 3.3e-38.
QSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTM ASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFG FSTLALVEKYSSPGLTSK
CRIM |
---|
PFAM accession number: | PF16978 |
---|---|
Interpro abstract (IPR031567): | CRIM is a domain in the middle of Sin1 protein that is important in the substrate recognition of TORC2. It is conserved from yeast to humans. TOR is a serine/threonine-specific protein kinase and forms functionally distinct protein complexes referred to as TORC1 and TORC2 [ (PUBMED:24610629) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRIM