The domain within your query sequence starts at position 139 and ends at position 276; the E-value for the CRIM domain shown below is 3.3e-38.

QSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTM
ASARVQDLIGLICWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFG
FSTLALVEKYSSPGLTSK

CRIM

CRIM
PFAM accession number:PF16978
Interpro abstract (IPR031567):

CRIM is a domain in the middle of Sin1 protein that is important in the substrate recognition of TORC2. It is conserved from yeast to humans. TOR is a serine/threonine-specific protein kinase and forms functionally distinct protein complexes referred to as TORC1 and TORC2 [(PUBMED:24610629)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRIM