The domain within your query sequence starts at position 171 and ends at position 233; the E-value for the CRM1_C domain shown below is 4.3e-22.

QLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSND
PQM

CRM1_C

CRM1_C
PFAM accession number:PF08767
Interpro abstract (IPR014877):

CRM1 (also known as exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran.

This entry represents the C-terminal domain of CRM1. It forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat [(PUBMED:15574331)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CRM1_C