The domain within your query sequence starts at position 327 and ends at position 415; the E-value for the CS domain shown below is 5.4e-15.

KNDSYEKGPDSVVVHVYVKEIRRDSSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFR
WQVKLRNLIEPEQCTFCFTASRIDICLRK

CS

CS
PFAM accession number:PF04969
Interpro abstract (IPR007052):

The bipartite CS domain, which was named after CHORD-containing proteins and SGT1 [(PUBMED:10571178)], is a ~100-residue protein-protein interaction module. The CS domain can be found in stand-alone form, as well as fused with other domains, such as CHORD (IPR007051), SGS (IPR007699), TPR (IPR019734), cytochrome b5 (IPR001199) or b5 reductase, in multidomain proteins [(PUBMED:12372593)].

The CS domain has a compact antiparallel beta-sandwich fold consisting of seven beta-strands [(PUBMED:12372593), (PUBMED:14761955)].

Some proteins known to contain a CS domain are listed below [(PUBMED:12372593)]:

  • Eukaryotic proteins of the SGT1 family.
  • Eukaryotic Rar1, related to pathogenic resistance in plants, and to development in animals.
  • Eukaryotic nuclear movement protein nudC.
  • Eukaryotic proteins of the p23/wos2 family, which act as co-chaperone.
  • Animal b5+b5R flavo-hemo cytochrome NAD(P)H oxydoreductase type B.
  • Mammalian integrin beta-1-binding protein 2 (melusin).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CS