The domain within your query sequence starts at position 1 and ends at position 257; the E-value for the CSF-1 domain shown below is 9.5e-123.

MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQME
TSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN
SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS
RGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRP
EDSSLTQDEDRQVELPV

CSF-1

 CSF-1
PFAM accession number:PF05337
Interpro abstract (IPR008001):

Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [ (PUBMED:11897698) ] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [ (PUBMED:12379742) ].

GO component:integral component of membrane (GO:0016021)
GO function:growth factor activity (GO:0008083), cytokine activity (GO:0005125)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CSF-1