The domain within your query sequence starts at position 31 and ends at position 171; the E-value for the CSN8_PSD8_EIF3K domain shown below is 2.3e-41.

IATPPVYGQLLALYLLQNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIY
TTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLE
QGWQADSTTRMVLPRKPASGT

CSN8_PSD8_EIF3K

CSN8_PSD8_EIF3K
PFAM accession number:PF10075
Interpro abstract (IPR033464):

This domain is conserved from fungi, plants to humans. It is a signature protein motif found in components of CSN (COP9 signalosome) where it functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development [(PUBMED:14636993)]. It is found in Eukaryotic translation initiation factor 3 subunit K, a component of the eukaryotic translation initiation factor 3 (eIF-3) complex required for the initiation of protein synthesis [(PUBMED:17581632)]. It is also found in 26S proteasome non-ATPase regulatory subunit 8 (PSMD8), a regulatory subunit of the 26S proteasome [(PUBMED:7621825)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CSN8_PSD8_EIF3K