The domain within your query sequence starts at position 61 and ends at position 280; the E-value for the CSRNP_N domain shown below is 5e-106.

LRRKNVRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHRE
ILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPT
KRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRLYCDPEACACSQAGIKCQVDRM
SFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELES

CSRNP_N

CSRNP_N
PFAM accession number:PF16019
Interpro abstract (IPR031972):

This presumed domain is found at the N terminus of cysteine/serine-rich nuclear proteins. These proteins act as transcriptional activators [(PUBMED:17726538)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CSRNP_N