The domain within your query sequence starts at position 1 and ends at position 949; the E-value for the CTC1 domain shown below is < 1e-12.

MTLGELAQAGSQVSIIVQIPAQMVWHRVLRPGRAYVLTKLQVTKTRIHLSCIWTTIPSST
LKPLRPGYVQELELDLEFSKADLKPPPQPTSSKDSRGQEGLVRASKVLHYLGTVTAVLHE
SAGLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQAVGGATTKPVLALCLHGT
VRLQGFSCLKPLTLPSSKVYGASLYEQLVWKCQLGLPLYLWAAKTLEDLIYKLCPHVLRC
HQFLKQPSPGKPSLGLQLLAPSWDVLIPPGSPMRHAYSEILEEPHNCPLQKYTPLQTPYS
FPTMLALAEEGQHRAWATFDPKAMLPLPEASHLTSCQLNRHLAWSWVCLPSCVFQPAQVL
LGVLVASSRKGCLELRDLRGSLPCIPLTESSQPLIDPNLVGCLVRVEKFQLVVEREVRSS
FPSWEEMGMARFIQKKQARVYVQFYLADALILPVPRPTFGSEPSQTASSCPEGPHLGQSR
LFLLSHKEALMKRNFCLLPGDSSQPAKPTLSFHVSGTWLCGTQRKEGSGWSPPESLAVES
KDQKVFLIFLGSSVRWFPFLYPNQVYRLVASGPSTPVFETEGSAGTSRRPLELADCGSCL
TVQEEWTLELGSSQDIPNVLEVPRTLPESSLAQLLGDNSPDSLVSFSAEILSRILCEPPL
ALRRMKPGNAGAIKTGVKLTVALEMDDCEYPPHLDIYIEDPQLPPQIGLLPGARVHFSQL
EKRISRSNIVYCCFRSSTSVQVLSFPPETKASAPLPHIYLAELLQGDRPPFQATTSCHIV
YVLSLQILWVCAHCTSICPQGKCSRRDPSCPSQRAVSQANIRLLVEDGTAEATVICRNHL
VARALGLSPSEWSSILEHARGPGRVALQFTGLGGQTESASKTHEPLTLLLRTLCTSPFVL
RPVKLSFALERRPTDISPREPSRLQQFQCGELPLLTRVNPRLRLVCLSL

CTC1

CTC1
PFAM accession number:PF15489
Interpro abstract (IPR029156):

In animals and plants, CTC1 is a component of the CST complex (consists of Ten1, Stn1 and CTC1), a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation [(PUBMED:19854130)].

Two distinct telomere capping complexes have evolved: CST complex in budding yeast and shelterin complex in vertebrates. Budding yeast CST is composed of Cdc13, Ten1 and Stn1 [(PUBMED:20697207)]. The homologues of Ten1 and Stn1 have been identified in vertebrates and plants. The vertebrate CST complex does not appear to play a primary role in telomere protection, but may complement the function of shelterin complex [(PUBMED:19854130)]. The mammalian CST complex may have both telomeric and non-telomeric function [(PUBMED:19854130)].

In plants, the contribution of the CST components to chromosome end protection, telomeric DNA replication or both processes remains to be determined [(PUBMED:20697207)].

GO function:single-stranded DNA binding (GO:0003697)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTC1