The domain within your query sequence starts at position 313 and ends at position 396; the E-value for the CTF_NFI domain shown below is 3.8e-19.

PNDVDAGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSG
QATGQHSQRQAPPLPTGLSASDPG

CTF_NFI

CTF_NFI
PFAM accession number:PF00859
Interpro abstract (IPR000647):

Nuclear factor I (NF-I) or CCAAT box-binding transcription factor (CTF) [(PUBMED:2504497), (PUBMED:2339052)] (also known as TGGCA-binding proteins) are a family of vertebrate nuclear proteins which recognise and bind, as dimers, the palindromic DNA sequence 5'-TGGCANNNTGCCA-3'. CTF/NF-I binding sites are present in viral and cellular promoters and in the origin of DNA replication of Human adenovirus 2 (HAdV-2). The CTF/NF-I proteins were first identified as nuclear factor I, a collection of proteins that activate the replication of several Adenovirus serotypes (together with NF-II and NF-III) [(PUBMED:6216480)]. The family of proteins was also identified as the CTF transcription factors, before the NFI and CTF families were found to be identical [(PUBMED:3398920)]. The CTF/NF-I proteins are individually capable of activating transcription and DNA replication. In a given species, there are a large number of different CTF/NF-I proteins, generated both by alternative splicing and by the occurrence of four different genes. CTF/NF-1 proteins contain 400 to 600 amino acids. The N-terminal 200 amino-acid sequence, almost perfectly conserved in all species and genes sequenced, mediates site-specific DNA recognition, protein dimerisation and Adenovirus DNA replication. The C-terminal 100 amino acids contain the transcriptional activation domain. This activation domain is the target of gene expression regulatory pathways elicited by growth factors and it interacts with basal transcription factors and with histone H3 [(PUBMED:8543151)].

GO process:regulation of transcription, DNA-templated (GO:0006355), DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:DNA binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTF_NFI