The domain within your query sequence starts at position 1 and ends at position 259; the E-value for the CTNNB1_binding domain shown below is 9.1e-93.
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGSLQSRQTLKDARSPSP AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS PYYPLSPGTVGQIPHPLGW
CTNNB1_binding |
---|
PFAM accession number: | PF08347 |
---|---|
Interpro abstract (IPR013558): | This region tends to appear at the N terminus of proteins also containing DNA-binding HMG (high mobility group) boxes ( IPR009071 ) and appears to bind the armadillo repeat of CTNNB1 (beta-catenin), forming a stable complex. Signalling by Wnt through TCF/LCF is involved in developmental patterning, induction of neural tissues, cell fate decisions and stem cell differentiation [ (PUBMED:15765502) ]. Isoforms of HMG T-cell factors lacking the N-terminal CTNNB1-binding domain cannot fulfil their role as transcriptional activators in T-cell differentiation [ (PUBMED:10080941) (PUBMED:9783587) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTNNB1_binding