The domain within your query sequence starts at position 44 and ends at position 85; the E-value for the CTP_transf_3 domain shown below is 2.8e-13.
AALVLARGGSKGIPLKNIKRLAGVPLIGWVLRAALDAGVFQR
CTP_transf_3 |
---|
PFAM accession number: | PF02348 |
---|---|
Interpro abstract (IPR003329): | Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase ( EC 2.7.7.43 ) (CMP-NeuAc synthetase) catalyzes the reaction of CTP and NeuAc to form CMP-NeuAc, which is the nucleotide sugar donor used by sialyltransferases [ (PUBMED:8663048) ]. The outer membrane lipooligosaccharides of some microorganisms contain terminal sialic acid attached to N-acetyllactosamine and so this modification may be important in pathogenesis. This family also includes 8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase found in the bacterial genus Shewanella, which is important in the development of the outer cell membrane and converts 3-deoxy-d-manno-octulosonic acid to 8-amino-3,8-dideoxy-d-manno-octulosonic acid (KDO8N) for incorporation into the lipopolysaccharide [ (PUBMED:23413030) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTP_transf_3