The domain within your query sequence starts at position 26 and ends at position 152; the E-value for the CTP_transf_like domain shown below is 2.6e-32.
WCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKW VDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVS TTDLVGR
CTP_transf_like |
---|
PFAM accession number: | PF01467 |
---|---|
Interpro abstract (IPR004821): | Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase [ (PUBMED:16344011) ], ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, archaeal FAD synthase RibL [ (PUBMED:20822113) ], and a number whose function is unknown. Many of these proteins are known to use CTP or ATP and release pyrophosphate. |
GO process: | biosynthetic process (GO:0009058) |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTP_transf_like