The domain within your query sequence starts at position 347 and ends at position 470; the E-value for the CTU2 domain shown below is 2.3e-21.

SIHRLMEAFILRLQTLFPSTVSTVYRTSEKLVKAPREGCAAGPSGPSCLLCMCALDIDTA
DSATAFGAQSSSHLSQMPSAEAGMPTQPCCAAGEGQAQSCHREVGKRGDARACITEQLCY
SCRV

CTU2

CTU2
PFAM accession number:PF10288
Interpro abstract (IPR019407):

Cytoplasmic tRNA 2-thiolation protein 2 (also known as Ncs2/Tuc2 in budding yeasts) is responsible for 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln) [(PUBMED:18664566), (PUBMED:18391219)]. Its fission yeast homologue, Ctu2 forms a complex with Ctu1 (Ncs6/Tuc1 homologue) and serves as a putative enzyme for the formation of 2-thiouridine [(PUBMED:19151091)].

GO process:tRNA wobble uridine modification (GO:0002098), tRNA thio-modification (GO:0034227)
GO function:tRNA binding (GO:0000049)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CTU2