The domain within your query sequence starts at position 162 and ends at position 233; the E-value for the CUTL domain shown below is 3.9e-46.
LEDLPAEQWNHATVRNALKELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQE FGRWYKKYKKIK
CUTL |
---|
PFAM accession number: | PF16557 |
---|---|
Interpro abstract (IPR032355): | The CUTL domain is part of the N-terminal region of SATB proteins, special AT-rich sequence-binding proteins that are global chromatin organisers and gene expression regulators essential for T-cell development and breast cancer tumour growth and metastasis. This domain carries a DNA-binding region [ (PUBMED:22241778) ]. |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CUTL