The domain within your query sequence starts at position 176 and ends at position 247; the E-value for the CUTL domain shown below is 1.6e-46.

LEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQE
FGRWYKHFKKTK

CUTL

CUTL
PFAM accession number:PF16557
Interpro abstract (IPR032355):

The CUTL domain is part of the N-terminal region of SATB proteins, special AT-rich sequence-binding proteins that are global chromatin organisers and gene expression regulators essential for T-cell development and breast cancer tumour growth and metastasis. This domain carries a DNA-binding region [(PUBMED:22241778)].

GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CUTL