The domain within your query sequence starts at position 66 and ends at position 157; the E-value for the CWC25 domain shown below is 8.2e-24.

KEEKLDWMYQGPGGMVNRDEYLLGRPIDKYVFEKMEEREAGCSSETGLLPGSIFAPSGAN
SLLDMASKIREDPLFIIRKKEEEKKREVLNNP

CWC25

CWC25
PFAM accession number:PF12542
Interpro abstract (IPR022209):

This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with . There is a single completely conserved residue Y that may be functionally important. Cwc25 has been identified to associate with pre-mRNA splicing factor Cef1/Ntc85, a component of the Prp19-associated complex (NTC) involved in spliceosome activation. Cwc25 is neither tightly associated with NTC nor required for spliceosome activation, but is required for the first catalytic reaction.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CWC25