SMART: Pfam domain CXCL17

The domain within your query sequence starts at position 23 and ends at position 111; the E-value for the CXCL17 domain shown below is 2.8e-50.

SPNPGVARSHGDQHLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKG
REKKNRHQKHHRKSQRPSRACQQFLKRCH

CXCL17

PFAM accession number:	PF15211
Interpro abstract (IPR029183):	C-X-C chemokine 17 (CXCL17) or dendritic cell and monocyte chemokine-like protein (DMC), is a cytokine-like protein that regulates recruitment of nonactivated blood monocytes and immature dendritic cells into tissues [ (PUBMED:16455961) ]. It may play a role in the innate defense against infections [ (PUBMED:17307946) ]. It also plays a role in angiogenesis and possibly in the development of tumours [ (PUBMED:16989774) ].

PFAM accession number:

PF15211

Interpro abstract (IPR029183):

C-X-C chemokine 17 (CXCL17) or dendritic cell and monocyte chemokine-like protein (DMC), is a cytokine-like protein that regulates recruitment of nonactivated blood monocytes and immature dendritic cells into tissues [ (PUBMED:16455961) ]. It may play a role in the innate defense against infections [ (PUBMED:17307946) ]. It also plays a role in angiogenesis and possibly in the development of tumours [ (PUBMED:16989774) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CXCL17