The domain within your query sequence starts at position 23 and ends at position 126; the E-value for the CXCL17 domain shown below is 2.8e-43.
SPNPGVARSHGDQHLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKG REKKNRTPKAPQEVAKTLQSLPAISQTMSPGKLCAALIVLRLCS
CXCL17 |
---|
PFAM accession number: | PF15211 |
---|---|
Interpro abstract (IPR029183): | C-X-C chemokine 17 (CXCL17) or dendritic cell and monocyte chemokine-like protein (DMC), is a cytokine-like protein that regulates recruitment of nonactivated blood monocytes and immature dendritic cells into tissues [ (PUBMED:16455961) ]. It may play a role in the innate defense against infections [ (PUBMED:17307946) ]. It also plays a role in angiogenesis and possibly in the development of tumours [ (PUBMED:16989774) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CXCL17