The domain within your query sequence starts at position 6 and ends at position 136; the E-value for the CYTL1 domain shown below is 4.3e-65.
LPLLLLLVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRYLPRLY LDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDDCSALE DPIPEATGPPD
CYTL1 |
---|
PFAM accession number: | PF15153 |
---|---|
Interpro abstract (IPR029253): | Cytokine-like protein 1 (CYTL1) was identified as a secretory protein expressed in CD34+ haemopoietic cells [ (PUBMED:10857752) ]. CYTL1 seems to regulate chondrogenesis and is required for the maintenance of cartilage homeostasis [ (PUBMED:17644814) (PUBMED:21652695) ]. It may also work as a regulatory factor in embryo implantation [ (PUBMED:26800213) ]. This family of proteins, CYTL1, is found in vertebrates. Proteins have two conserved sequence motifs: PPTCYSR and DDC. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CYTL1