The domain within your query sequence starts at position 397 and ends at position 524; the E-value for the CaMKII_AD domain shown below is 2.7e-62.

RKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSK
NSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNV
HYHCSGAP

CaMKII_AD

CaMKII_AD
PFAM accession number:PF08332
Interpro abstract (IPR013543):

Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity [(PUBMED:3291115)]:

  • Serine/threonine-protein kinases
  • Tyrosine-protein kinases
  • Dual specificity protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)

Protein kinase function is evolutionarily conserved from Escherichia coli to human [(PUBMED:12471243)]. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation [(PUBMED:12368087)]. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [(PUBMED:15078142)], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [(PUBMED:15320712)].

This domain is found at the C terminus of the Calcium/calmodulin dependent protein kinases II (CaMKII). These proteins also have a Ser/Thr protein kinase domain (IPR000719) at their N terminus [(PUBMED:12603201)]. The function of the CaMKII association domain is the assembly of the single proteins into large (8 to 14 subunits) multimers [(PUBMED:14993460)] and is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release.

GO process:protein phosphorylation (GO:0006468)
GO function:calmodulin binding (GO:0005516), calmodulin-dependent protein kinase activity (GO:0004683)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CaMKII_AD