The domain within your query sequence starts at position 1 and ends at position 255; the E-value for the Ca_hom_mod domain shown below is 5.6e-94.

MDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNVVYSLGILLTPP
LVLFLLGLVMNNNISMLAEEWKRPAGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLD
GKCFLCAFCTAVPVATLGNGSLVPGLPAPELARLLARVPCPEIYDGNWLLAREVAVRYLR
CISQALGWSFVLLTTLLAFVVRSVRPCFTQVAFLKSKYWSHYIDIERKLFDETCTEHAKA
FAKVCIQQFFEAMNH

Ca_hom_mod

Ca_hom_mod
PFAM accession number:PF14798
Interpro abstract (IPR029569): This entry represents a group of voltage-gated ion channel proteins, including calcium homeostasis modulator protein 1/2/3/4/5/6 [(PUBMED:23884934)]. This family is also known as FAM26 proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ca_hom_mod