The domain within your query sequence starts at position 446 and ends at position 536; the E-value for the Cache_1 domain shown below is 1e-31.

WTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFT
LCPNGYYFAIDPNGYVLLHPNLQPKPIGVGI

Cache_1

Cache_1
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cache_1