The domain within your query sequence starts at position 673 and ends at position 818; the E-value for the Cadherin_C domain shown below is 3.9e-46.

KRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVVPTFI
PTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVFDYEGSGSDAASLSSLTTSA
SDQDQDYNYLNEWGSRFKKLADMYGG

Cadherin_C

Cadherin_C
PFAM accession number:PF01049
Interpro abstract (IPR000233): Cadherins are transmembrane glycoproteins vital in calcium-dependent cell-cell adhesion during tissue differentiation [(PUBMED:3061804)]. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn [(PUBMED:9566976)]. The cytoplasmic region is highly conserved in sequence and has been shown experimentally to regulate the cell-cell binding function of the extracellular domain of E-cadherin, possibly through interaction with the cytoskeleton [(PUBMED:3061804)]. This domain is found upstream of the cadherin domain IPR002126.
GO process:homophilic cell adhesion via plasma membrane adhesion molecules (GO:0007156)
GO function:calcium ion binding (GO:0005509)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cadherin_C