The domain within your query sequence starts at position 686 and ends at position 769; the E-value for the Cadherin_C_2 domain shown below is 1.9e-25.

ALTLYLVTALASVSSLFLLSVMLFVGVRLCRRARAASLGGCTVPEGHFPDHLMGINSAGT
LSQSYQYEVCLMGGSGTNEFRFLK

Cadherin_C_2

Cadherin_C_2
PFAM accession number:PF16492
Interpro abstract (IPR032455):

This entry represents the cytoplasmic C-terminal domain of some proto-cadherins. It is this region of the cadherins that allows cell-adhesion and the essential feature of metazoan multicellularity. Cadherins are cell-surface receptors that function in cell adhesion, cell polarity, and tissue morphogenesis [ (PUBMED:1568244) (PUBMED:22837400) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cadherin_C_2