The domain within your query sequence starts at position 813 and ends at position 947; the E-value for the Cadherin_tail domain shown below is 5.4e-58.

PRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPV
GAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPANNQIDKSDFITFGK
KEETKKKKKKKKGNK

Cadherin_tail

Cadherin_tail
PFAM accession number:PF15974
Interpro abstract (IPR031904):

This is the cytoplasmic catenin-binding domain found at the C terminus of cadherin [(PUBMED:9865466)]. This domain binds to the ARM domain of beta-catenin, a catenin that plays a crucial role in the regulation of cell-cell adhesion at adherens junctions (AJs) [(PUBMED:20371349)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cadherin_tail