The domain within your query sequence starts at position 132 and ends at position 236; the E-value for the Calx-beta domain shown below is 3.1e-11.

ASVTILSNDNAFGIISFSTPSSISVIEPRSRNASVPLTLIREKGTYGMVTVTFDVSGGPN
PPEEDLNPVRGNITFPPGRATVIYNVTVLDDEVPENDELFLIQLR

Calx-beta

Calx-beta
PFAM accession number:PF03160
Interpro abstract (IPR003644):

The calx-beta motif is present as a tandem repeat in the cytoplasmic domains of Calx Na-Ca exchangers, which are used to expel calcium from cells. This motif overlaps domains used for calcium binding and regulation. The calx-beta motif is also present in the cytoplasmic tail of mammalian integrin-beta4, which mediates the bi-directional transfer of signals across the plasma membrane, as well as in some cyanobacterial proteins. This motif contains a series of beta-strands and turns that form a self-contained beta-sheet [(PUBMED:9294196), (PUBMED:10390612)].

GO process:cell communication (GO:0007154)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Calx-beta