The domain within your query sequence starts at position 3781 and ends at position 3872; the E-value for the Calx-beta domain shown below is 6.9e-3.
LFNRVPEPTENITVVQLHIVRDKGLFGDISIHLIAKPNFLLHINNQATEDEDFVLQDSVI IMKENIKETHAEVAILPDEVPELDEGLIVTIA
Calx-beta |
![]() |
---|
PFAM accession number: | PF03160 |
---|---|
Interpro abstract (IPR003644): | The calx-beta motif is present as a tandem repeat in the cytoplasmic domains of Calx Na-Ca exchangers, which are used to expel calcium from cells. This motif overlaps domains used for calcium binding and regulation. The calx-beta motif is also present in the cytoplasmic tail of mammalian integrin-beta4, which mediates the bi-directional transfer of signals across the plasma membrane, as well as in some cyanobacterial proteins. This motif contains a series of beta-strands and turns that form a self-contained beta-sheet [(PUBMED:9294196), (PUBMED:10390612)]. |
GO process: | cell communication (GO:0007154) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Calx-beta