The domain within your query sequence starts at position 1 and ends at position 202; the E-value for the Caprin-1_C domain shown below is 8.2e-95.

XSSLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPANEPETLKQQSQ
YQATYNQSFSSQPHQVEQTELQQDQLQTVVGTYHGSQDQPHQVPGNHQQPPQQNTGFPRS
SQPYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSNTPNSGYSQSQFTAPR
DYSGYQRDGYQQNFKRGSGQSG

Caprin-1_C

Caprin-1_C
PFAM accession number:PF12287
Interpro abstract (IPR022070):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 343 and 708 amino acids in length. This family is the C-terminal region of caprin-1. Caprin-1 is a protein involved in regulating cellular proliferation. In mutated phenotypes, the G1 phase of the cell cycle is greatly lengthened, impairing normal proliferation. The C-terminal region of caprin-1 contains RGG motifs which are characteristic of RNA binding domains. It is possible that caprin-1 functions through an RNA binding mechanism.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caprin-1_C