The domain within your query sequence starts at position 171 and ends at position 757; the E-value for the Carn_acyltransf domain shown below is 7.7e-167.

LPRQPVPSAQETVRKYLESVRPVLGDDAFDRATALANDFLRLHAPRLQLYLQLKSWCTSN
YVSDWWEEFVYLRSRGSLINSTYYMMDFLYVTPTPLQAARAGNAVHTLLLYRHLLNRQEI
SPTLLMGMRPLCSAQYERMFNTTRIPGVEKDHLRHLQDSRHVAVFHRGRFFRVGTHSPNG
LLSPRALEQQFQDILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAATALEAVEGA
AFFVSLDSEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHS
WADCPVSGHLWEFTLATECFQLGYATDGHCKGHPDPTLPQPQRLQWDLPEQIQPSISLAL
RGAKTLSGNIDCHVFPFSHFGKSFIKCCHVSSDSFIQLVLQLAHFRDRGQFCLTYESAMT
RLFLEGRTETVRSCTREACQFVRAMDNKETDQHCLALFRVAVDKHQALLKAAMSGQGIDR
HLFALYIMSRLLHMQSPFLTQVQSQQWLLSTSQVPVQQTHLIDVHNYPDYVSSGGGFGPA
HDHGYGISYIFMGENAITFHISSKKSSTETDSHRLGQHIENALLDVA

Carn_acyltransf

Carn_acyltransf
PFAM accession number:PF00755
Interpro abstract (IPR000542):

A number of eukaryotic acetyltransferases can, on the basis of sequence similarities, be grouped together into a family. These enzymes include:

  • Choline o-acetyltransferase EC 2.3.1.6, an enzyme that catalyses the biosynthesis of the neurotransmitter acetylcholine [(PUBMED:3480542)].
  • Carnitine o-acetyltransferase EC 2.3.1.7 [(PUBMED:8420957)].
  • Peroxisomal carnitine octanoyltransferase EC 2.3.1.137, a fatty acid beta-oxidation pathway enzyme which is involved in the transport of medium-chain acyl-coenzyme A's from peroxisome to mitochondria [(PUBMED:3233218)].
  • Mitochondrial carnitine palmitoyltransferases I and II EC 2.3.1.21 (CPT), enzymes involved in fatty acid metabolism and transport [(PUBMED:8449948)].
  • Mycoplasma pneumoniae putative acetyltransferase C09_orf600.

GO function:transferase activity, transferring acyl groups (GO:0016746)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Carn_acyltransf