The domain within your query sequence starts at position 142 and ends at position 221; the E-value for the Casein domain shown below is 1.5e-22.

IPSLASLANLHLPQSLVQLLAQVVQAFPQTHLVSSQTQLSLPQSKVLYFLQQVAPFLPQD
MSVQDLLQYLELLNPTVQFP

Casein

Casein
PFAM accession number:PF00363
Interpro abstract (IPR001588):

Caseins [(PUBMED:3074304)] are the major protein constituent of milk. In milk, caseins interact with calcium phosphate, forming large stable colloidal particles termed micelles. These micelles make it possible to maintain a supersaturated calcium phosphate concentration in milk, providing the newborn with sufficient calcium phosphate for the mineralisation of calcified tissues [(PUBMED:7619062)]. Caseins can be classified into two families; the first consists of the kappa-caseins, and the second groups the alpha-s1, alpha-s2, and beta-caseins. The alpha/beta caseins are a rapidly diverging family of proteins [(PUBMED:16386026), (PUBMED:3952000)]. However two regions are conserved: a cluster of phosphorylated serine residues and the signal sequence.

Alpha-s2 casein is known as epsilon-casein in mouse, gamma-casein in rat and casein-A in guinea pig. Alpha-s1 casein is known as alpha-casein in rat and rabbit and as casein-B in guinea pig.

GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Casein