The domain within your query sequence starts at position 22 and ends at position 181; the E-value for the Casein_kappa domain shown below is 2.7e-70.

EIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLNFNQYEPNYYHYRPSLPATASPYMYYPL
VVRLLLLRSPAPISKWQSMPNFPQSAGVPYAIPNPSFLAMPTNENQDNTAIPTIDPITPI
VSTPVPTMESIVNTVANPEASTVSINTPETTTVPVSSTAA

Casein_kappa

• PFAM accession number: PF00997
• Interpro abstract (IPR000117):

  Kappa-casein is a mammalian milk protein involved in a number of important physiological processes [ (PUBMED:9409842) ]. In the gut, the ingested protein is split into an insoluble peptide (para kappa-casein) and a soluble hydrophilic glycopeptide (caseinomacropeptide). Caseinomacropeptide is responsible for increased efficiency of digestion, prevention of neonate hypersensitivity to ingested proteins, and inhibition of gastric pathogens.

• GO component: extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Casein_kappa