The domain within your query sequence starts at position 1369 and ends at position 1431; the E-value for the Caskin-tail domain shown below is 7.2e-33.
RQKLEETSACLAAALQAVEEKIRQEDGQGPRPSSIEEKSTGSILEDIGSMFDDLADQLDA MLE
Caskin-tail |
 |
|---|
| PFAM accession number: | PF16632 |
|---|---|
| Interpro abstract (IPR032117): | This domain is found at the C terminus of Caskin proteins. Caskins are CASK-binding synaptic scaffolding proteins [ (PUBMED:12040031) ]. Part of this domain is predicted to be in coiled-coil conformation. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caskin-tail