The domain within your query sequence starts at position 1369 and ends at position 1431; the E-value for the Caskin-tail domain shown below is 7.2e-33.

RQKLEETSACLAAALQAVEEKIRQEDGQGPRPSSIEEKSTGSILEDIGSMFDDLADQLDA
MLE

Caskin-tail

Caskin-tail
PFAM accession number:PF16632
Interpro abstract (IPR032117):

This domain is found at the C terminus of Caskin proteins. Caskins are CASK-binding synaptic scaffolding proteins [(PUBMED:12040031)]. Part of this domain is predicted to be in coiled-coil conformation. Its function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caskin-tail