The domain within your query sequence starts at position 373 and ends at position 421; the E-value for the Caskin1-CID domain shown below is 3e-26.

EEIWVLRKPFAGGDRSGSLSNVAGGRSTGGHALHAGSEGVKLLATVLSQ

Caskin1-CID

Caskin1-CID
PFAM accession number:PF16600
Interpro abstract (IPR032232):

The Caskin1 protein interacts with the CASK protein via this region [(PUBMED:12040031)]. CASK and Caskin1 are synaptic scaffolding proteins. The binding motif on human Caskin1 is EEIWVLRK. A similar motif is found on protein MINT1 and protein TIAM1, both shown to be able to bind to CASK though the motif. However, MINT1 and TIAM1 are not included in this entry [(PUBMED:21763699)]. This region is predicted to be natively unstructured.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caskin1-CID