The domain within your query sequence starts at position 25 and ends at position 141; the E-value for the CathepsinC_exc domain shown below is 1.5e-48.

DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHF
TLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKK

CathepsinC_exc

CathepsinC_exc
PFAM accession number:PF08773
Interpro abstract (IPR014882):

Cathepsin C (dipeptidyl peptidase I) is the physiological activator of a group of serine proteases. This protein corresponds to the exclusion domain whose structure excludes the approach of a polypeptide apart from its termini. It forms an enclosed beta barrel structure composed from 8 anti-parallel beta strands [ (PUBMED:11726493) ]. Based on a structural comparison and interaction data, it is suggested that the exclusion domain originates from a metallo-protease inhibitor [ (PUBMED:11726493) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CathepsinC_exc