The domain within your query sequence starts at position 13 and ends at position 146; the E-value for the Caudal_act domain shown below is 4.8e-31.

VYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPTWAAPFPAPKDDW
AAAYGPGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPGAPSSPGAPRRTP
YEWMRRSVAAAGGG

Caudal_act

Caudal_act
PFAM accession number:PF04731
Interpro abstract (IPR006820): This domain occurs at the N-terminal of proteins belonging to the caudal-related homeobox protein family. This region is thought to mediate transcription activation. The level of activation caused by mouse Cdx2 (P43241) is affected by phosphorylation at serine 60 via the mitogen-activated protein kinase pathway [(PUBMED:11729123)]. Caudal family proteins are involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium, and are important in differentiation and maintenance of the intestinal epithelial lining. Caudal proteins always have a homeobox DNA binding domain (IPR001356).
GO process:multicellular organism development (GO:0007275), regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Caudal_act