The domain within your query sequence starts at position 147 and ends at position 231; the E-value for the Cbl_N2 domain shown below is 2.3e-48.
LYQLTKGSAHIFWRQNCGVRCVLPWAEFQSLLCACHPVEPGPTMQALRSTLDLTCNGHVS VFEFDVFTRLFQPWPTLLRNWQLLA
Cbl_N2 |
---|
PFAM accession number: | PF02761 |
---|---|
Interpro abstract (IPR014741): | Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface. The N-terminal region of Cbl contains a Cbl-type phosphotyrosine-binding (Cbl-PTB) domain, which is composed of three evolutionarily conserved domains: an N-terminal four-helix bundle (4H) domain, an EF hand-like calcium-binding domain, and a divergent SH2-like domain. The calcium-bound EF-hand wedges between the 4H and SH2 domains, and roughly determines their relative orientation. The Cbl-PTB domain has also been named Cbl N-terminal (Cbl-N) or tyrosine kinase binding (TKB) domain [ (PUBMED:10078535) (PUBMED:18840649) ]. The N-terminal 4H domain contains four long alpha-helices. The C and D helices in this domain pack against the adjacent EF-hand-like domain, and a highly conserved loop connecting the A and B helices contacts the SH2-like domain. The EF-hand motif is similar to classical EF-hand proteins. The SH2-like domain retains the general helix-sheet-helix architecture of the SH2 fold, but lacks the secondary beta-sheet, comprising beta-strands D', E and F, and also a prominent BG loop [ (PUBMED:10078535) ]. This entry represents the EF hand-like domain. |
GO function: | calcium ion binding (GO:0005509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cbl_N2