The domain within your query sequence starts at position 283 and ends at position 356; the E-value for the Cep57_MT_bd domain shown below is 2.5e-20.

QSSGEPVSICDSLSELLMTMEEELDQMNMEHRELLRQMMQPGNHSVSEDIEQELEQLAKK
MESKGDQISKLKKH

Cep57_MT_bd

Cep57_MT_bd
PFAM accession number:PF06657
Interpro abstract (IPR024957):

This C-terminal domain of Cep57 binds, nucleates and bundles microtubules. The N-terminal part of the protein is the centrosome localisation domain [(PUBMED:18294141)].

GO function:microtubule binding (GO:0008017)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Cep57_MT_bd